SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VGC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VGC9
Domain Number 1 Region: 218-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000893
Family LIM domain 0.045
Further Details:      
 
Domain Number 2 Region: 278-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000011
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  F6VGC9
Domain Number - Region: 182-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0471
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VGC9
Sequence length 620
Comment (tr|F6VGC9|F6VGC9_MACMU) Prickle planar cell polarity protein 3 {ECO:0000313|Ensembl:ENSMMUP00000030313} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PRICKLE3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHA
VPVDLERIMCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYV
NSPGEKYRIKQLLHQLPPHDSEAQYCTALEEEEKKELRAFSQQRKRENLGRGIVRIFPVT
ITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCRELLVDLIYFYHAGKVYCG
RHHAECLRPRCQACDEIIFSPECTEAEGRHWHMDHFCCFECEASLGGQRYVMRQSRPHCC
ACYEARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLI
FCSRACSLGSEPTAPGPGRRSWSAGTVTAPLAASTASFSAAEGASETTTKGTCTESAPAT
GPEEPSRFLRGAPHRHSMPELGLRSAPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL
VSEGGPRRTLSAPPAQRRRPRSPPPRAPSRHRHRHNHHHHHHHHHRHPSRRRHYQCDAGS
GSDSGSCSSSPSSSSSESSEDDGFFLGERIPLPPHLCRPMPAQDNATETFNSPSLSLPRD
SRPGMPRQTRQTRDKNCIVA
Download sequence
Identical sequences A0A2K5MSR6 A0A2K5WJ07 F6VGC9
ENSMMUP00000030313 XP_001105952.1.72884 XP_005593598.1.63531 XP_011887580.1.92194 ENSMMUP00000030313 9544.ENSMMUP00000030313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]