SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VLP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VLP2
Domain Number 1 Region: 45-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 2 Region: 165-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000237
Family Pentraxin (pentaxin) 0.011
Further Details:      
 
Domain Number 3 Region: 859-1140
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000394
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VLP2
Sequence length 1250
Comment (tr|F6VLP2|F6VLP2_HORSE) Adhesion G protein-coupled receptor G6 {ECO:0000313|Ensembl:ENSECAP00000013011} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ADGRG6 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MMLPSGRMWSCHWKWKRSSLLFFFALYIVCVPHSVWGCASCRLILSNPSGAFTSPCYPND
YPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDALSLDNGESQTKFCGATAKGLSF
NSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVVLPLTLDAHQVSVAKSVSIPEL
SAFTLCFEATKIGKEDTEWIAFSYSNASFTQLLSFGKAKDGYFLSISDSKCFLSNVLPVK
DKEDIFTESFEQLCVVWDNSLGSVGVNFKRNYEAVPCDSTISKVIPGNGRLLLGSDQSEI
ASLKGDIYNFRLWNFTMNSKTLANLSCSVKGNVVDWQNDFWNIPTVALKAESNLSCGSYL
IPLPAAELASCADLGTLCRATVNSPCTTPPTVTTNMPVTNRIGKQSNDGIAYRISIVIQN
VLRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSTGEDKIKVKRSLVIDQRFVIWA
LLIYNATNNPSLEGEVIQQKLLRNNESLDEGLRLYTVNVRQLGECLPAENPKGYQWPTIS
PSEYKHPCLEKQGFYASRTCHPAPNSTSSAYWGTPDLSNCSKEANEVANQILNLTGDGQT
LNSANITSIVEQVRRIVNKEENIDITLGSTLMNIFSNILTSPDSDLLESSSEALKTIDEL
AFKIDLSSTSHVNITTRNLALGVSSLSPGTNEISNFSIGLPSNNESYFQMDFASEQMDPL
ASVMLPPNLLENLSQEDSVLVKRVQFTFFNKTGLFQDVETKKGTLVSYVMACSIGNITIQ
GLKDPVRIKIKHARSQAVHHPVCAFWDLDNGEASGFWNTSGCVTQGHSDASETVCLCNHL
THFGVLMDLQGTASQMDARNTRILTFLTYIGCGISAIFSATTLLTYVAFEKLRRDYPSKI
LMNLSTALLFLNLIFLLDGWITSFHVDGLCTAVAALLHFFLLATFTWMGLEAIHMYIALV
KVFNTYIRRYILKFCIIGWGLPALVVSIVLASRKQNEVYGKESYGKEQGDEFCWIQDPVV
FYVTCAGYFGVMFFLNFAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMT
WGFAFFAWGPLNVAFMYLFSIFNSLQGLFIFVFHCAMKENVQKQWRRHLCCGRFRLADNS
DWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDSASTDKPS
SKLTHADGEQTSIIPVHQVLDKVKGYCNAHSDNFYKNIIMSDSFSHSTKF
Download sequence
Identical sequences F6VLP2
ENSECAP00000013011 9796.ENSECAP00000013011 ENSECAP00000013011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]