SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VN95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VN95
Domain Number 1 Region: 236-385
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 126-235
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-24
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 40-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VN95
Sequence length 1052
Comment (tr|F6VN95|F6VN95_MONDO) FERM domain containing 4A {ECO:0000313|Ensembl:ENSMODP00000021106} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FRMD4A OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKIVLKKAWFLTSFPICIYFDLRGKKCKDLEEPGHSRMTEGRRCQVHLLDDRKLELLVQP
KLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPVVLYFC
VRFYIESISYLKDNATIELFFLNAKSCIYKELIEVDSEVVFELASYILQEAKGDFSSNEI
VRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPTYGV
HYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPR
RASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIA
IDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEAL
EETLRQRLEELKKLCLREAELTGKLPREYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGE
EAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINDNR
IKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDEDSQVTSTISPLQSPHKGLPPRPPS
HNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSHSHSSSHKRF
PSTGSCAEAGGSNSLQNSPIRGLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLH
SLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHY
YPAQMNPNYSTLAEDSPSKARERQRQRHKSAGNLVSSNSGSMPNLAARNGTGHHGVYLHS
QSQPSSQYRIKEYPLYIEGSSTPVVVRSLENDQEGHYSVKAQFKTSNSYTAGGMFKENWH
GDEGDSVRLTPSRSQIIRTPSLGREGHHEKSSGRTVVSDELRLWYQRSTASHKEHSRLSH
TSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSAALPHSQRSSTPSSEIGATPPSS
PHHILTWQSGEATENSPTMDESESPTHQSTDE
Download sequence
Identical sequences F6VN95
ENSMODP00000021106 ENSMODP00000021106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]