SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VR04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VR04
Domain Number 1 Region: 54-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-36
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 2 Region: 211-337
Classification Level Classification E-value
Superfamily TIMP-like 2.04e-36
Family Netrin-like domain (NTR/C345C module) 0.00000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VR04
Sequence length 342
Comment (tr|F6VR04|F6VR04_MONDO) Procollagen C-endopeptidase enhancer {ECO:0000313|Ensembl:ENSMODP00000005539} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PCOLCE OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRADEGTGGRGFLLWYSGRATSGNGTPPGARRKWGADPRVDWAAWGYWDEHQFCGGRLEK
PQGTLTTPNWPESDYPPGVSCSWLIIAPPEQVISLTFGKFDLEPDTYCRYDSVSIFNGVQ
SDDSKRLGKYCGDTAPSSITSEGNELLVQFVSDLSVTADGFSASYKAQPRGSGKEGAVPA
PPQPQPGPKVKLPDKPQENLKPTLPTDSDVPSTPCPKQCRRTGTLQSNFCANDFVVTGTA
KSMVRGPREGITVTVTLMGIYKAGALALSSTSVGTPLKLYVPCRQCPPIKKGASYLLMGS
VDEKGGAVLPPNSFVVLYRPNQDQILTNLSKKKCPSQPLAGA
Download sequence
Identical sequences F6VR04
ENSMODP00000005539 ENSMODP00000005539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]