SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VRS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VRS4
Domain Number 1 Region: 971-1099
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-20
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VRS4
Sequence length 1116
Comment (tr|F6VRS4|F6VRS4_XENTR) Anillin actin-binding protein {ECO:0000313|Ensembl:ENSXETP00000000726} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=anln OC=Silurana.
Sequence
FSQDTERKLLERTRARRENLQKKMADRPTAGARPAALNKRQREPLLEANNQPPAPAEEGK
PCSKPSPSKRRCSDNDATPDSGSENKQPKSPELPRNETSTVAFHQQIKVSNQTPQVSLLS
SDKELTNSNMKAAGSVKTRMQKLADQRRYWDNNVLFVVSPSSSPPAHAPPKDIMVSPPKP
QIPTVEYDTPSVRRGRFANLAATISSWEDDLSHPCVKPNNKQEKPGTACLSKDSTTSSAS
ASINSHSVRQDTASCSQRPKDTTVNKAVCSGQLDQHTLDKSVVDSTEITEKSKSPTAITY
KPNENVLPASRTLNPQKTERPASRLYSNQPASTRNGINITPVQTQQKDKVATSGGAGIKS
FLERFGEKCQEHSPAPLNQGQRTAVLTPNTKSIQERLLKQNDISSTASLAQQQKKEREKE
LAALRGRYDRGNVWIKQQDEQRKYIHLLLLKHCQKSCLKIKHAVILFKNFLDNFHPIMAE
QVPSPQKSTTLVQSQMPSECPGLENSETLTRVKTMKMHWGPAYISPANVMWEIEMNVDGS
LEEINSSGVITNIFSDILGQHDEEEEEVAECLVEQVETATDDEEREDEEEDALNISSMSL
LAPLAETVGIESPKALLSPSNRAAAGNGESCGKRQSGKLQRKHLPRAESNDSLRSLEENQ
NLLYSIDAYRSQRFKETDRLPVKQTIVRKEDVSSRLHDKKTASPRSVNIKQRMKALNNEV
NLQQTVIHQASQALNCCIDEEHGKGSETEAEAEKLLIVATEKRAALIAELNKIKNEGPQS
QKKHVSNENAPSRGCIFVSEMFLPLKADFVCNASQRMDSANYYFFMMIRAGAENMVATPL
ASISSTMKGDALAFPTTFSLEDVSNDFEICVEVYSLVQKKEGLAPDKKKKTMKSKAITPK
RLLTSITNKSNIHTPALASPGGPNAVRTSNFVLVGSHKLTLSSIGSSKFLLDKVPFLSPL
EGHIYLKIKCQVNSSVEEKGFLTMFEDVSGFGAWHRRWCVLSGYCISYWTYPDDEKRKNP
IGRVNLANCTSRKIEPANREFCARPNTFELITVRPQREGDRETLVSQCRDTLCVTKNWLS
ADTKDERNLWMQKLNQVLVDLRMWQPDACYRPTTKP
Download sequence
Identical sequences F6VRS4
ENSXETP00000000726 ENSXETP00000000726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]