SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VSD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VSD4
Domain Number 1 Region: 357-615
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-59
Family Creatinase/aminopeptidase 0.0001
Further Details:      
 
Domain Number 2 Region: 82-173
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.0000000112
Family Creatinase/prolidase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VSD4
Sequence length 657
Comment (tr|F6VSD4|F6VSD4_HORSE) X-prolyl aminopeptidase 1 {ECO:0000313|Ensembl:ENSECAP00000020397} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=XPNPEP1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
LRANHQDFLLKNLRIIEPNEVTHTGDPGVETDSRMAPKVTSELLRQLRQAMRNLEYVTEP
IQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQM
DSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPV
KENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVVWFVVTALDEIA
WLFNLRGSDVEHNPVFFSYAVIGLETIMLFIDGDRIDTPSVKEHLLLDLGLEAEYRIQVL
PYKSILSKLKALCADLSPREKVWVSDKASYAVSEAIPKDHRCCMPYTPICIAKAVKNSAE
SEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISS
TGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPKAYEKECFTY
VLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISY
KTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVP
IQTKMIDVDSLTDKECDWLNNYHLTCRDVVGKELQKQGRQEALEWLIRETQPISRQH
Download sequence
Identical sequences F6VSD4
9796.ENSECAP00000020397 ENSECAP00000020397 ENSECAP00000020397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]