SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VTL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VTL6
Domain Number 1 Region: 479-847
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.14e-128
Family Hect, E3 ligase catalytic domain 0.00000000475
Further Details:      
 
Domain Number 2 Region: 12-107
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.18e-20
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 
Domain Number 3 Region: 425-463
Classification Level Classification E-value
Superfamily WW domain 0.000000000000127
Family WW domain 0.00014
Further Details:      
 
Domain Number 4 Region: 135-178
Classification Level Classification E-value
Superfamily WW domain 0.000000000000195
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 295-335
Classification Level Classification E-value
Superfamily WW domain 0.000000000000682
Family WW domain 0.0017
Further Details:      
 
Domain Number 6 Region: 375-410
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6VTL6
Sequence length 854
Comment (tr|F6VTL6|F6VTL6_ORNAN) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=NEDD4 OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MYDPVRGCLTSIQTKTVKKTLNPKWNEEIFFRVHPQQHRLLFEVFDENRLTRDDFLGQVD
VPLYQLPTENPNLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTNGSEEENTEQAEE
LEPGWIILDQPDAACHLQQQQESSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPTPQDS
ITEAESGNIQLQAQHAFTTRRQISDETEILENRESPESWDIITEDEATMYSHQNIQSPPT
PSNFDIQSHLAEELNARLTTVGNTATSRQASSSHHSSRRDNVQTYTVEEQPALPVLLPTS
SGLPPGWEEKQDDKGRSYYIDHNSRTTTWMKPAIQATLEAGQPSSSQSSSLSHQPQTAAT
DPSQHSLHQQPELQQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRRKTS
LDPIDLGPLPPGWEERTHTDGRLFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKY
EFFRKKMKKQSDIPNRFEMKLRRTAILEDSYRRIIAVKRADFLKARLWIEFDGEKGLDYG
GVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAV
YHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLQWIIENDPTELDLRFTVDEEL
FGQTHQHELKADGSEIVVTNKNKKEYIHLVIQWRFVNRVQKQMAAFKEGFFELIPQDLIK
IFDENELELLMCGLGDVDVNDWREHTKYKNGYNVNHQVIQWFWKAVLMMDSEKRIRLLQF
VTGTSRVPMNGFAELYGSNGPQFFTVEQWGSPDKLPRAHTCFNRLDLPPYESFEDLWDKL
HVAIENTQGFDGVD
Download sequence
Identical sequences F6VTL6
XP_007667439.1.37387 ENSOANP00000013575 ENSOANP00000013575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]