SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VU58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VU58
Domain Number 1 Region: 627-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000058
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-39
Family Third domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-36
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-22
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-19
Family PDZ domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6VU58
Sequence length 922
Comment (tr|F6VU58|F6VU58_MONDO) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PTPN4 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNLRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAIQSELGDYDHSENLPGYLSDYSFIPGQ
PQDFEKEVAKLHQQHIGLSPAEAEFNYLNTARTLELYGVELHYARDQSNNEIMIGVMSGG
ILINKNRIRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDERLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHIVHTSPSEVFVNHRSPSSTQANSIILESSPSQENSEDGQPPALPPKQSKKNSWNQINF
SYSQQDLDNHINETFDVPTSPEKSTPNGGIPHDNLVVIKMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTSADLCVPRLNEGDQVVLINGRDIAEHTHDQVVMFIKASCERHSGELVLL
VRPNAVYDVVEEKFENEPDFQYIPEKSPLDGVHQNDNALRESMIQLAEGLDTGTILTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKENDDYINANYINMEIPSSSII
NQYIACQGPLPNTCMDFWQMTWEQGSSVVVMLTTQVERGRVKCHQYWPELTESSSYGNFQ
VTCHSEEGNSAYVFRNITLYNLEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YKFVCEAILKVYEEGFIKPVKT
Download sequence
Identical sequences F6VU58
ENSMODP00000000389 ENSMODP00000000389 XP_016289073.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]