SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VU91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VU91
Domain Number 1 Region: 476-540,582-680
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-31
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 2 Region: 687-813
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1100-1228
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000183
Family Second domain of FERM 0.0071
Further Details:      
 
Weak hits

Sequence:  F6VU91
Domain Number - Region: 1001-1078
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000195
Family Ubiquitin-related 0.05
Further Details:      
 
Domain Number - Region: 26-134,587-607
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000555
Family BAR domain 0.094
Further Details:      
 
Domain Number - Region: 1235-1294
Classification Level Classification E-value
Superfamily PH domain-like 0.00541
Family Third domain of FERM 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6VU91
Sequence length 1370
Comment (tr|F6VU91|F6VU91_HORSE) Pleckstrin homology, MyTH4 and FERM domain containing H1 {ECO:0000313|Ensembl:ENSECAP00000020165} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PLEKHH1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
PEVDSIMAELKVESRTSVDWQKRCLALETQLFRFRLQASKIRELLADKMQELEQRLLEAE
QRAENAETQVGMMEEKVKLSSLKNVDSAGSLHRKYQELLKAVQGKDELIGQLEAQLEKQK
QMRAEEAKIVQEKAAKIKEWVTLKLAELEMENQHLKSCNQHLVEQVGALQDALGALQMAP
SGKLRVAPQGALEEDSVPSGLGTQLMGQDSGPQAQGALKVAIPAPSPGTLQNKDSVAKTG
SLFEDSSASMVHPGEISEAKTLPPRLGREGSPGQLCVKPHTPRHGLASWGEGLVTAQGGM
LPGTKTSARGGGPGSSLTLPKVRAPSTPRDSIQLAKRHHSQPQAGPGHFNQVVSIEIGTL
SALHPSSLPEVQARAELREEPEKMEMEEQPPAGKKEDRESPRAPRAELEEVDLGNKPPTP
PLHRFPSWESRIYAVATSGMRLSDVSPRNNVTCCTSSPPALASPGPFSGLVYKNVTVPVY
TALKGRATQISTVPFVDESSGSDDDCSSQASFRTSLPCSESRKTSGLGSPRAIKRGVSMS
SLSSEGDYAIPPDACSLDSDYSEPEHKLQRTSSYSMDGLGLGGESLEKSGYLLKMGSRVK
TWKRRWFVLRQGQIMYYKSPSDVIRKPQGQVELNSRCQIVRGEGAQTFQLICEKKTYYLT
ADSPSLLEEWIRVLQSLLKVQAIGPPALPQAGTKPTVKGWLTKVKHGHSKLVWCALVGRT
FYYYRSHEDKRPLGRLPVRDARIEEVDRSGDSDEDYEAGGTGRLLSSHCTLVIHPPEHSP
TYLLIGTKHEKDTWLYHLTVAAGGPSAKVGTAYEQLIGKLMDGEGDPDSPLWKHPMLCYS
KDGLYTSLTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPEL
QSEIYCQLMKQTSCRPPQKHSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRNET
GQYATYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGF
DGSSTVDEFLQRLNQETGMRKSSHSGFALFTDDPSGRDLEHCLQGSVKICDAISRWEQAL
KELHSGKSEGGTRVVKLMYKNRLYFRSQVKGETERERLLLASQTSGEIVAGRFPVNKELA
LEMAALMAQVEYGDLERPIPPGPGGTPPAKAQHHLQQVLDRFYPRRYRHEAPPEQLRHLA
DLLTTKWAALQGSPPEVIRIFLTVAGKWLSLGAKLFAAQPAQLSSKENALVWIAVNEDGV
SILDHNTMQVHVTYPYSSVMTFGGCRDDFMLVIRSNPDHSSGKGHIEKLIFRMAAPKIAE
ATFIMASYMNHCSATVNPPTSPPAARQPWELDGRQFFPSVPRAAKGPTLL
Download sequence
Identical sequences F6VU91
ENSECAP00000020165 ENSECAP00000020165 9796.ENSECAP00000020165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]