SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VUA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VUA1
Domain Number 1 Region: 28-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-44
Family GABARAP-like 0.00000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VUA1
Sequence length 144
Comment (tr|F6VUA1|F6VUA1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000036305} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
GGNQTQRINPLCCSQTPRGRSETLRSIMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIV
EKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQ
LYEDNHEEDYFLYVAYSDESVYGK
Download sequence
Identical sequences F6VUA1
ENSMODP00000036305 13616.ENSMODP00000036305 ENSMODP00000036305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]