SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VWF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VWF8
Domain Number 1 Region: 138-333
Classification Level Classification E-value
Superfamily E set domains 4.25e-81
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000989
Further Details:      
 
Domain Number 2 Region: 32-154
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-23
Family Voltage-gated potassium channels 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6VWF8
Sequence length 335
Comment (tr|F6VWF8|F6VWF8_HORSE) Potassium voltage-gated channel subfamily J member 4 {ECO:0000313|Ensembl:ENSECAP00000020858} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=KCNJ4 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
NGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAF
LVSWLFFGLLFWCIAFFHAQRGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCV
TEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCL
MWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIV
HEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVV
FEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESK
Download sequence
Identical sequences F6VWF8
ENSECAP00000020858 9796.ENSECAP00000020858 ENSECAP00000020858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]