SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VWZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VWZ8
Domain Number 1 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VWZ8
Sequence length 499
Comment (tr|F6VWZ8|F6VWZ8_MACMU) Potassium two pore domain channel subfamily K member 5 {ECO:0000313|Ensembl:ENSMMUP00000011777} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_14866 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTRRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSAASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLAPLVVYSKNRVPTLEEVSQ
TLRSKGHVSRPPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI
TFVNAEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSDESTFTSTESELS
VPYEQLMNEYNKANSPKGT
Download sequence
Identical sequences A0A2K5VDV3 F6VWZ8
9544.ENSMMUP00000033743 ENSMMUP00000011777 ENSMMUP00000033743 XP_001117117.1.72884 XP_005553165.1.63531 ENSMMUP00000011777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]