SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6VXF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6VXF8
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 595-773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.46e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 193-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-36
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 399-589
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 5 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000533
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6VXF8
Sequence length 835
Comment (tr|F6VXF8|F6VXF8_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000001493} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
AREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKSADYVNLALKD
GAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDY
TMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKI
YGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQ
ERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGR
SGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIR
DLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKDGWNRFICDCTGT
GYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSAD
TLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKSLKLTV
DDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGLLYIDLCKNG
DIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSADGFILFNS
GDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKVD
TKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRLPDLI
NDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCND
Download sequence
Identical sequences F6VXF8
9796.ENSECAP00000001493 ENSECAP00000001493 ENSECAP00000001493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]