SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6W0L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6W0L0
Domain Number 1 Region: 23-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-96
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Weak hits

Sequence:  F6W0L0
Domain Number - Region: 294-340
Classification Level Classification E-value
Superfamily UBA-like 0.0397
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6W0L0
Sequence length 780
Comment (tr|F6W0L0|F6W0L0_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000026300} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SIK1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVIMSEFTSVPISNQTQQRPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKA
RLDPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHL
SENEARKKFWQILSAVEYCHSHHIVHRDLKTENLLLDASMNIKLADFGFGNFYKSGEPLS
TWCGSPPYAAPEVFEGKEYEGPHLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRF
RIPFYMSQDCETLIRRMLVVDPAKRITIAQIKHHKWMQADPSLPRSPGLAFSVHNYSSNL
GDYNEQVLGMMQTLGISKQRTVESLQNSSYNHFAAIYYLLLERLKEYRSTQPSTCSGPGE
LPRSRSSDPSPLETPPEGLAADAFRSSLLPQHPQSLAPAVLQEAMDFDLNHPLQPLFFSA
DPSVSGLLRNGFISPNSLLETTISEEVRQDQDLEEEVKAQHPGHPPSSTANRRHTLAEVT
SHLYQRSPPCIVISSCTSPAEGTSSDSCLTSSSSNGSGGLSSCLNGQVLMADSSDVKLAS
PFLVAQCDTPGQKLEGGLGRAALLPLSFQEGRRASDTSLTQGLKAFRQQLRKNTRAKGLL
GLNKINGLARQACQASSGRATRGCLNSSQHYQPNPCLYSSGGKGREGENLLEEVLHQQRL
LQLQHNTSVHLSCPQAPQLSQAQYVISACDESYPEANPLLTCGAHPHLFKGSVSPVSSAA
QLLDSPLGIHSHPSLATPSFPQQPHFAIWSPSYDPAVLHQGDYEMEDLTSPQVGKFVLVQ
Download sequence
Identical sequences F6W0L0
ENSMODP00000026300 13616.ENSMODP00000026300 XP_001364783.1.35504 XP_016288633.1.35504 ENSMODP00000026300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]