SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6W7T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6W7T0
Domain Number 1 Region: 74-198
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6W7T0
Sequence length 205
Comment (tr|F6W7T0|F6W7T0_HORSE) Ral GEF with PH domain and SH3 binding motif 1 {ECO:0000313|Ensembl:ENSECAP00000018011} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=RALGPS1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SAKFSRRPTCPDASVAGSLPTPPVPRHRKSHSLGNNRGRLYATLGPNWRVPVRNSPRTRS
CVYSPTGPCICTLGSSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGA
KSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAI
LWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences F6W7T0
ENSECAP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]