SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WA88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WA88
Domain Number 1 Region: 390-468
Classification Level Classification E-value
Superfamily HMG-box 2.62e-26
Family HMG-box 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WA88
Sequence length 598
Comment (tr|F6WA88|F6WA88_XENTR) Transcription factor Sox-6 {ECO:0000313|Ensembl:ENSXETP00000035030} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sox6 OC=Silurana.
Sequence
GTPESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIA
RQQQQLLQQQHKINILQQQIQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGLSYK
PGDNYPMQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKIPTTPQPANAPGTLS
PTGMKSEKRGTSPVAQIKDEAAQPLNLSARPKTADPIKSPTSPTQSFFPVSKTSPVSLSN
KSGIPSPIRGPSLDILSSLNSPALFGDQDTVMKAIQEARKMREQIQREQLLTPHSIDGKL
PINNMGLNNCRSDKMLLDAVTGKICIRSAHTERTHFENLGPQLTGKPNEDGKLGPGVIDL
TRPEDVEGGATVVEARVYRDTRGRSSSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSN
ISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEY
KQLMRSRRQEMRQFFTVGQQPQIPISTPTGVVYPGAISMATTTPSPQMTSDCSSTSASPE
PSIPVIQSTYGMKLDSGSLGGNDLMNGEDEMEMYDDFEDDPKSDYSSDNEANEAVSAN
Download sequence
Identical sequences F6WA88
ENSXETP00000035026 ENSXETP00000035030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]