SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WAB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WAB7
Domain Number 1 Region: 29-154,186-551
Classification Level Classification E-value
Superfamily Sema domain 5.1e-177
Family Sema domain 0.0000000000577
Further Details:      
 
Domain Number 2 Region: 613-696
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000303
Family I set domains 0.042
Further Details:      
 
Domain Number 3 Region: 547-598
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000314
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WAB7
Sequence length 785
Comment (tr|F6WAB7|F6WAB7_HORSE) Semaphorin 3F {ECO:0000313|Ensembl:ENSECAP00000006527} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SEMA3F OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MPVAGLLLWASLLTGAWPATLTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDGNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQAMSWTQMQVVRGRGNRATDGTFRLTPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNEPSFIHAELVPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQEMEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPSDRRREIRAEDRFLRTE
QGLLLRALQLGDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPPAVSAPPPAGA
GLPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPRDAPGAPRPPEPQDQKKPRNRRH
HPPDT
Download sequence
Identical sequences F6WAB7
ENSECAP00000006527 ENSECAP00000006527 9796.ENSECAP00000006527 XP_001496563.1.31192 XP_008528016.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]