SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WBS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6WBS5
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0392
Family Inhibitor of apoptosis (IAP) repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WBS5
Sequence length 69
Comment (tr|F6WBS5|F6WBS5_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000008975} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSDHPTSPHTPQTPHCHSLRTTKSDFYIWSRFKFLPCLFFFFFLKQFSKVLKGKSEFLWI
LLVPALRFF
Download sequence
Identical sequences F6WBS5
13616.ENSMODP00000008975 ENSMODP00000008975 ENSMODP00000008975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]