SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WCS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WCS4
Domain Number 1 Region: 99-131,212-286
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.04e-16
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WCS4
Sequence length 341
Comment (tr|F6WCS4|F6WCS4_CALJA) Solute carrier family 26 member 4 {ECO:0000313|Ensembl:ENSCJAP00000030107} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SLC26A4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRHRLAVPSVLAAVVIANLKGMFMQVCDVPRLWRQNKTDAVIWVFTCIVSIILGLDLGLL
AGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNV
DGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRATKNGIVSDAGSTNNAFEPDE
DIEDLEELDIPTKEIEIRVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDIVGVKSLRVI
VKEFQRIDVNVYFASLQDHVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQGGQ
DSILEAITFIQDCKDPLELIEAELTEEELDVQDEAMRTLAT
Download sequence
Identical sequences F6WCS4
ENSCJAP00000030107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]