SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WCU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WCU7
Domain Number 1 Region: 1219-1296
Classification Level Classification E-value
Superfamily Immunoglobulin 7.81e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 835-908
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000142
Family I set domains 0.057
Further Details:      
 
Domain Number 3 Region: 617-670
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000115
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 328-388
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 383-443
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000785
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 6 Region: 481-535
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000968
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 1119-1195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000132
Family I set domains 0.053
Further Details:      
 
Domain Number 8 Region: 673-730
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 9 Region: 726-791
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000575
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 10 Region: 1388-1455
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 11 Region: 559-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number 12 Region: 250-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000432
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 13 Region: 1516-1572
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 14 Region: 1338-1394
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000902
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WCU7
Sequence length 1608
Comment (tr|F6WCU7|F6WCU7_MONDO) ADAMTS like 3 {ECO:0000313|Ensembl:ENSMODP00000024184} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ADAMTSL3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SLFLFRILISFSLCRSCEGQNIRYKTCSNNDCPSDAGDFRAQQCSAYNDVQYQGHYYEWL
PIYDDSAAPCALKCQARGQNLVVELAPKVLDGTRCNIDSLDMCISGICQAIGCDRQLGSN
AKEDNCGVCAGDGSTCRLVRGQSKSHVSPEKREENVIAVPLGSRSVRITVKGPAHLFIES
KTLQGSKGEHSFAAPGVFVIENTTVEFLRGSDRETFKIPGPLGADFIFKTRYTTSRDSVV
QFFFYQPISHQWRQTDFFPCTVTCGGGYQLNSAECVDVRLKRVVPDHYCHYYPENTKPKP
KLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMH
GEILQVEEWKCMYAPKPKVMQTCNLFDCPKWIAMEWSPCTVTCGRGLRYRVVLCINHNGQ
HVGGCNPQLKLHIKEECIIPVPCYKPKEKNPVEAKLPWFKQAQELEETRTAASEEPAFIP
EPWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKPFTERPCLLEACDDVPA
VRGLDFSWNEKDRETIYDWEYVGFTPCSATCLGGKREAIARCLHIQTHQAVNDTLCDKAH
RPPPMTQSCNTDPCPPRWQTGSWRPCSATCGVGIQTRDVNCLQPGEPLVPSEECKDEKPH
VLQACNQFDCPPGWHIEEWQQCSRTCGGGTQYRRVTCRQLLTDGSFLNLSDELCQEPRAS
SHKSCARTDCPPQLVLGDWSKCSVSCGVGIQRRKPICQRLTAKGRNVTLNGSLCSGRPHA
PLIRSCRMAMCNMIKPEIIPKYGAHGPQILGIKRVYIQTREEKRINFTIGGRAYLLPKTS
VVIKCPVRRFQKALIQWEKDGQRLQNSKRFGITKSGSMKIHSLEASDIGLYRCVAGPVHE
TFVLKLIGTDNRLIEPPAFRDHPLEHGRIDHNEANSLGATWHKMRQIWSQQNELYLDDGQ
VSDQPLLRALIQHGNNPAENPNSLEFKDKFLEAAVLQGSYSMDTAQFEELIKNMSQLIET
GEVNDDIASQVIYEVVAELAKVQPTREKSRGAQIESSTTKLNMKIQNVSSSSNSKNPNRL
TFKQKGFALMKQNKVPNISFNKTINSRIGSTVFITQSTEIINLFCDLIKTNDAKYAWTKD
GVLLQPSEKIILDGTRKIQIRNPTKEEQGVYGCSVLNHLHSDTKSSSVLYAEVPVILTVA
RNITELERGRLTVIVGGTAKARVGANITIRCPAKGIPQPHITWFKRGGSLNDNAFLLFNG
SLLLKNVSLENEGTYVCTATNALGKAMAASVLHLFEPRNPDMKVNLPKGNKKHVLRSSNI
STSISSMTTGQMLHIEYNWEPGEWTHCSATCGNLGSRVQRPQCLTTKRQKVSETFCDPLQ
KPQNLVQPCNRRDCPARWLASNWSECSVSCGNGFRHRQITCERVKASGIVQTMSPNACAH
KDRPLGRKRCWGQACGEWAVQLGSQCAGQCPGRAQEMQRLPELCQHRNGSAVLDLDCAER
KRSNMRRNCSSEPCDVYWRTGPWRPCTAACGNGFQSRKVECVHRKSSRPVAVHHCGSRQR
PVSWKHCNVTSCGRECKDTTHYCTFVKNLNLCSIDLYKQRCCQSCQEA
Download sequence
Identical sequences F6WCU7
ENSMODP00000024184 ENSMODP00000024184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]