SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WDU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WDU9
Domain Number 1 Region: 560-678
Classification Level Classification E-value
Superfamily Cadherin-like 5.76e-31
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 240-365
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-30
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 463-564
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 136-244
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 668-776
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-17
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 352-461
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.0074
Further Details:      
 
Weak hits

Sequence:  F6WDU9
Domain Number - Region: 29-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000251
Family Cadherin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WDU9
Sequence length 1237
Comment (tr|F6WDU9|F6WDU9_MACMU) Protocadherin-9 isoform 1 {ECO:0000313|EMBL:AFE63630.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_09361 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSA
SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPN
DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYE
LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQV
TVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK
RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDL
RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPVFNQPVIELSVSE
NNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIF
TVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD
AGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAK
VTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG
NNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN
ASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIIAGAMVVIVVIFVTVLVRCRH
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPI
NGTISLPAELEEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKK
HHVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQGGFKTKGPLHTRQCNSHSKSD
NIPVTPQKCPSSAGFHIQENEESHYESQRRVTFHLPDGSQESCSDSGLGDHEPVGSGTLI
SHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPRGLAEATEMCTQECLVLGHSD
NCWMPPGLGPYQHPKSPLSTFVPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGS
NEGHFNNGSHMTDIPLANLKSYKQAGGAIESPKEHQL
Download sequence
Identical sequences F6WDU9 G7PVH6
9544.ENSMMUP00000007428 ENSMMUP00000007428 NP_001245115.1.72884 XP_005586033.1.63531 ENSMMUP00000007428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]