SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6WFJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WFJ6
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.79e-33
Family Nucleoplasmin-like core domain 0.0000608
Further Details:      
 
Weak hits

Sequence:  F6WFJ6
Domain Number - Region: 125-155
Classification Level Classification E-value
Superfamily ARM repeat 0.00547
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WFJ6
Sequence length 216
Comment (tr|F6WFJ6|F6WFJ6_CALJA) Nucleoplasmin-2 {ECO:0000313|EMBL:JAB13909.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NPM2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MNLSSTSSTEEKAVTTVLWGCELSQERRTWTFRPQPKGKQDCKLLLHTICLGEKAKEEMH
RVEILPPGNREDKKTQPVTIASLQASVLPMVTMVGVQLSPPITFQLRAGSGPVFLSGHER
YETSDLTWEEEEEEEGEEDEEEEEEEDDEDEDVDISLEEESPVKQGKRLVPQKPTSVAKK
KKLEKEQEEVRPRVRDKSPEKKAKAIPRSKKPGFKK
Download sequence
Identical sequences F6WFJ6
ENSCJAP00000037903 ENSCJAP00000037912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]