SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WI13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WI13
Domain Number 1 Region: 118-332
Classification Level Classification E-value
Superfamily GFP-like 9.73e-62
Family Domain G2 of nidogen-1 0.0014
Further Details:      
 
Domain Number 2 Region: 29-120
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-24
Family I set domains 0.0088
Further Details:      
 
Domain Number 3 Region: 340-474
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.65e-17
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 478-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000373
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 576-679
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000926
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  F6WI13
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000278
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WI13
Sequence length 774
Comment (tr|F6WI13|F6WI13_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000019607} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MDDAGQYQCLAENEMGAVEKVVVLVLQSAPVIQVEPQNVTVRAGDDVALRCQATGEPAPT
VEWLRAGQPLQASWRLQTLPDGSLWLERVEAGDAGAYECVAHNLLGSASARAFLAVRGEP
RGSRGSVIGVINGQEFGVATLNTSVQQEARSGVTTIRSSINHIPASVGPLMRVLVVTIAP
IYWALAGESGEALNGHSLTGGSFRQESHVEFATGELLTMTQVARGLDPDGLLLLDVMVNG
VVPESLADADLQVQDFLERYVQTGPGRLFGGSTQRFLHDSLPAFLRCNHSIQYDTARGPQ
PQLVQNLRASAVSSAFDPEAEALRFQLAAALQAEENEVGCPEGFELDAQGEFCVDRDECS
GSPSPCSHSCHNAPGHFSCACPAGFALARDERNCRDVDECAWDAHPCREGQRCVNLLGSY
HCLPDCGPGFRVAADGAGCEDVDECLEQSDECHYNQICENTPGGHRCSCPRGYRLQGPGL
PCLDIDECLQLPRVCTHQCHNLQGGFRCLCPPGQTLLRDGKTCTPLERSGQNVTTVSLQG
ALVPWLRPRIPTPGGSYHAWVSLWPGPGALSSVGRAWCPPGFIRQNGICTDLDECRVRSL
CQHACRNTEGSYRCLCPAGYRLLPSGKNCQDINECEEDGIECGPGQMCFNTRGSYQCVDT
PCPATYRQGSSPGTCFRRCSLQDCGAGRPLHAAVPAAAAAAGRARPPRRGPPRRLLRGRR
PRQPHRAQRARARPAQPVRAASAAPRPRRRLHPQRAHPRRPLPAHRARRRATPP
Download sequence
Identical sequences F6WI13
ENSECAP00000019607 ENSECAP00000019607 9796.ENSECAP00000019607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]