SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WLW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WLW3
Domain Number 1 Region: 1286-1448
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-70
Family Pleckstrin-homology domain (PH domain) 0.00000362
Further Details:      
 
Domain Number 2 Region: 1078-1289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-53
Family DBL homology domain (DH-domain) 0.000000103
Further Details:      
 
Domain Number 3 Region: 494-609
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-20
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 851-962
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000186
Family PDZ domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WLW3
Sequence length 1679
Comment (tr|F6WLW3|F6WLW3_HORSE) T-cell lymphoma invasion and metastasis 2 {ECO:0000313|Ensembl:ENSECAP00000021426} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=TIAM2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MGNSESQYTLQGSKNHSHTITGAKQKPCSLKIRSIHAKDDKSLHGWGHGGSGAGYKSRSL
ARSCLSHFKSNQPYASRLGGPTCKVSKGSVCSKHRTNASGSDFQGSNVASSSENGFHYVG
HEPADNHVPSRDCNGHLLNCYGRHESVASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNG
DHHSPGPPGDSGGPVQLLRYSPTLTPGADSPPSTRLSATDSHPRSSKGSSLSSESSWYDS
PWGHAGEVGEAEGPFLASGTPDPSLHGFPPRDAQKPFNQSSSLSSLRELYPAATLGSLSP
SAVRLSDEYIGAHASLSHRVSFASDIDVPSRVEHRDPGQYASFTLPCRKSKALTEDTSKK
DTLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNADMPGPSWASATLWSG
GSAQILSQRSESAHAIGSDPLRQNIYENFMQELEMSRTNTENVETSTETAESSSESLSSL
EQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETY
GKNSTDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVT
AIHSACASLFAKKRGKEDTIRLLKNQTKNLIQKIDMDSKMKKMAELQLSVVSDPKNRKAI
ENQIQQWEQNLEKFHMDLFRTRCYLASLQGGELPNPKSLLAAASRPSKLALGRLGVLSVS
SFHALVCSRDDSALRKRKLSLTQRGRNKKGIFSSLKGLDTLARKAKEKRPSITQVDELLH
LYGSTVDGVPQDNTWEIQTYIHFQDNQGVTVVIKPEHRVEDILTLACKMRQLEPSHYGLQ
LRKLVDENIECCIPAPYEYMQEQVYDEIEVFPLNVYHVQLTKTGSVSDFGFAVTAQVDEH
QRLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVCDLDLKRMEALFSEKSVGLTLIAW
PPDTKGTLCSSWSDSDLSSRDQKSLLPPPNQSQLLEEFLDNFKKNTTNDFSNVPDITTGL
KRSQTDGTLDQVSHKERMEQTFRSAEQIPVLCRSFNDTQTDSMEGPREGEEATPRPLARH
LSDADRLRKVIQELVDTEKSYVKDLSCLFDLYLEPLQNETFLTQDEMESLFGSLPEMLEF
QKVFLETLEDGISAASDFNLLETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQK
VLERAKTDKAFKAFLDARNPTKQHSSTLESFLIKPVQRVLKYPLLLKELVSLTDHESEEH
YHLTEALKAMEKVASHINEMQKLYEDYGTVFDQLVAEQSGAEKEVTELSMGELLMHSTVS
WLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHSSADLDPFKFRW
LIPISALQVRLGNTAGTENNSVWELIHTKSEIEGRPETIFQLCCSDNESKTNIVKVIRSI
LRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSSEWPSEPGKG
SSLDSDEGSLSSSTQSSSCHTAGSRQDALQHPHTGLADFSDHLIKESDILSDEDEDYHQI
VKQGSPTKDIEIQFQRLRISDGPDAQLPGQQPGTDGQPGGEQPRLVRGHFCAIKRKANST
KRDRGTLLKTQTRHQSLDSQSENASLDLNSVLEREFSVQSLTSVVNEECFYETESHGKS
Download sequence
Identical sequences F6WLW3
ENSECAP00000021426 ENSECAP00000021426 9796.ENSECAP00000021426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]