SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WNR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WNR7
Domain Number 1 Region: 60-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000663
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WNR7
Sequence length 325
Comment (tr|F6WNR7|F6WNR7_MONDO) Corticotropin-releasing hormone-binding protein {ECO:0000256|PIRNR:PIRNR009279} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CRHBP OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRSRMSPAFKLQCHFILIFLGALRGETRYLELREVAEADPLLLFNTDLKRELSEEQLYHR
SLRCIDMLSIEGQFTFTAEQPQLQCAAFFIGEPEEVISIQYDLVSVDCQGGDFLKVFDGW
ILKGEKFPSSQDHPLPMSDRYIDFCESENIRTFSSSQNVAMIFFRIHEPGNGFTITVKKN
PNLFPCNVISQTPNGRFTMVIPHQHRNCSFSIIYPVVIKISDLILGHLNGLQLKKPSVGC
GGIGDFVELLGGTGLDPSKMMPFADLCYPFHGPAQLTIGCDNTVVRMVSSGKHVNRVTFE
YHQLEPYDLGSPSGNSIKEYCFPSI
Download sequence
Identical sequences F6WNR7
XP_001381651.2.35504 ENSMODP00000024647 ENSMODP00000024647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]