SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WPT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WPT0
Domain Number 1 Region: 79-90,214-261,299-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-51
Family Nuclear receptor ligand-binding domain 0.00000672
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-29
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WPT0
Sequence length 504
Comment (tr|F6WPT0|F6WPT0_CIOIN) nuclear receptor isoform X1 {ECO:0000313|RefSeq:XP_009858805.1} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN=ftzf OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MKYSLDEVCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNGKKYTCVHTSKCHIDKDQRKG
CQACRFQKCLRVGMKLEAVRRDRVRGGRNKFGPLYKQDRARKQRLKALSEVHDSSTTITN
LTLSVETTKVEFCEPVPLIQTPTPTNNECYVTPSHDSIWPSSLESPSTSSIMSVLPQPYI
SHSPSPNTSSLGSTGDLTVRNISGNSYIEPPTFHPPPDPMQTHYPLLWGAHPAMNPTLPP
TYLSMGPIPAPYQLLPFSPNSVIEGFQRGFYVPLLIDQLLKYEIVESEIKTRIGTSLLDV
THRSDVFQLICKIADQTLYAMVEWAKKSVFFADLQVSDQMKLLQDSWIELLILDHIQRQL
KLKSDSIELVTGHKFPRDLSKVSSHCVITFRILKRLMDLEKKFAVLQVDEQEIACLKYLV
LFDTESHTAGCPNVQEKVNEALCEYSKKNYMDQPDRVNKLIFRLSEIRAVSSQIEDYLHY
KHHEGKLTEGSLLVELLKARENGP
Download sequence
Identical sequences F6WPT0
ENSCINP00000009479 ENSCINP00000009479 XP_009858805.1.78797 7719.ENSCINP00000009479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]