SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WQA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WQA1
Domain Number 1 Region: 2275-2347
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-19
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 2 Region: 889-958
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.02e-19
Family TB module/8-cys domain 0.00068
Further Details:      
 
Domain Number 3 Region: 1626-1697
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-18
Family TB module/8-cys domain 0.00045
Further Details:      
 
Domain Number 4 Region: 2068-2202
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 470-594
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-18
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 6 Region: 1785-1911
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.46e-18
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 7 Region: 665-795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1993-2059
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-17
Family TB module/8-cys domain 0.0000869
Further Details:      
 
Domain Number 9 Region: 270-338
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-16
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 10 Region: 1257-1389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 1466-1539
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-16
Family TB module/8-cys domain 0.0000404
Further Details:      
 
Domain Number 12 Region: 786-870
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 13 Region: 2390-2515
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 124-209
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000012
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 15 Region: 1136-1275
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000298
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 16 Region: 1015-1139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000033
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 17 Region: 2161-2283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000105
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 18 Region: 592-681
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000144
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 19 Region: 2515-2632
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 20 Region: 1545-1600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000761
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 21 Region: 1949-1997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000983
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 22 Region: 228-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000171
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 23 Region: 970-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000244
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 24 Region: 2346-2395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 25 Region: 428-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 26 Region: 1382-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 27 Region: 1424-1470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000383
Family EGF-type module 0.00058
Further Details:      
 
Domain Number 28 Region: 1911-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000431
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 29 Region: 393-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000336
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  F6WQA1
Domain Number - Region: 61-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.033
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 96-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.08
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WQA1
Sequence length 2816
Comment (tr|F6WQA1|F6WQA1_XENTR) Fibrillin 2 {ECO:0000313|Ensembl:ENSXETP00000003713} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN= OC=Silurana.
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSTGQISPNCGSKT
IQQCSVRCMNGGTCVEDHCQCQKGYVGAHCGQPVCENGCQNGGRCIGPNRCACVYGFTGP
QCERDYRTGPCFTQVSNQMCQGQVTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGF
IPNIRSGACQDVDECQAIPGLCQGGNCINTDGSYECRCPVGHKQSETTQKCEDIDECTTI
PGVCNGGECSNTIGSYYCICPRGYVTSGDGSRCIDQRSGVCFSSLVNGHCAQEQAGRFTK
MQCCCESGRCWALGSIPEMCPIRGTDEYRRLCIEGVPFGGPGGFVPNGFGPGGTGFIPGP
GVPLYLSVSISSYYAPRIYCTFYTTLNQTIDICKQYPNLCLNGRCIPNLNSYRCECNMGY
KQDTQTECIDVDECTSNPCTNGDCVNTPGSYYCKCHSGFQRTPTKQACIDIDECIQNGIL
CKHGRCVNTEGSFQCICNAGFELTPDGKNCADHDECSTTNMCLNGMCINEDGSFKCICKP
GFVLASNGRYCTDIDECQTPGICMNGHCINTEGSFRCDCPPGLAIGVDGRVCVDTHMRST
CYGGIKKGLCVRPFPGAVTKSECCCANPDYGFGEPCHPCPPRNSAIAEFQGLCSGGVGIT
VDGRDINECALDPDICANGICENLRGSFRCNCNSGFESDSTGKNCIDIDECLVNRLLCDN
GLCRNTPGSYSCTCPKGYVFRSDSETCEDINECESSPCVNGACRNILGSFNCECSPGSRL
DATGLICIDSLKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPR
GFARVKGVSCEDVNECEVFPGVCPNGLCLNTKGSFLCECPDGLTLDGTGRLCLDLRMEHC
FLKWDEDECVHPVPGKFRLDACCCAVGAAWGTECEECPKPGSQEFELLCPRGPGFTNRGD
VLSGRPFYKDINECKAFPGICTNGKCRNTIGSFKCKCNNGFALDMEERNCTDIDECRISP
DLCGSGTCINTPGSFECECFEGFESGFMMMKNCMDIDECERNPLLCRGGECINTEGSFLC
NCPNGHELTPSGDACVDINECALSDNLCRNGKCVNIVGTYQCSCNPGYQATLDRLGCTDI
DECTIMNGGCDTHCTNSEGSYECSCLEGYALMPDKRTCTDIDECEDNPDICDGGQCTNIP
GEYRCLCFDGFMASMDMKTCIDVNECDINSNICMFGECENTKGSFVCHCQVGYAVKKGTT
GCTDVDECEIDTHNCHLHATCLNVPGSFKCTCKEGWIGNGIKCNDLDECLNGTHRCSVSA
HCLNTPGSYHCSCAEGYTGDGFTCSDVDECTENINLCENGQCLNIPGSYRCECDMGFTPA
SDSRSCQDIDECAFQNICVFGTCSNLPGMFRCICNEGYELDRTGGNCTDVDECADPINCV
NGFCVNTPGRYECNCPPDFQLNPTGVGCVDTRVGNCYLNHGARGDGTISCSTEIGVGVSR
SSCCCSLGKAWGNPCEICPPVNSSEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQG
GNCINTFGSFQCECPQGYYLSEETRICEDIDECFTHPGVCGPGTCYNTLGNYTCICPSEY
MQVNGGHNCMDMRKSFCYRTYNGTTCDNELPFNVTKKMCCCTYNIGKAWSKPCEPCPTPG
TANFKHLCGSIPGFTFDIHTGKAVVLLECLELCVNFLLDLHFYVLMCFNLLVKIFNKMLR
KILEMIIKYKVGKLKCXKMLIALNSPGTYRCECSTGFKLLPNGACIDRNECLEIPNVCSH
GTCVDTEGSYHCVCNNGFKVSPDQTMCMDIDECERQPCGNGTCKNTVGSYNCLCYPGFEI
THNNDCLDIDECSSLYGQVCRNGHCFNEIGSFICLCNEGYELTPDGKNCIDINECVAFPG
SCSPGTCQNLEGSFRCICPPGYEVERENCIDIDECIEEPNICLFGACSNTPGSFQCICPP
GFVLSENGRRCFVLDTRQSFCFTRFENGKCSVPKAYNSTKAKCCCSKMPGEGWGDPCELC
PKEGEVAFQDLCPYGHGTIPGIGDTREDVNECLENPGICANGHCINTDGSFRCECPMGYN
LDYTGVNCVDTDECSIGNPCGNGTCTNAIGTFECLCDEGFEPGPMMVCEDINECILNPLL
CAFRCINTYGAYECTCPAGYILREDQKMCKDLDECIEGFHDCESRGMVCKNLIGTFMCIC
PPGMVRRPDGEGCMDENECRTKPGICENGRCVNTIGSYRCDCNEGFQSTPSGTECLDTRQ
GFCFSEVLQTMCQMSSSSRNHVTKSECCCNGGRGWGNQCEICPLPGTAQYKKMCPHGPGY
TTDGKDIDECKVMPNLCRNGQCINNIGSYRCFCNPGYTTDIGGTACVDLDECSQSPKPCN
FICKNTEGSYQCSCPRGYILQEDGKSCKDLDECQTKQHNCQFLCVNTIGGFTCKCPPGFT
QHHTACIDNNECGTQSNVCGLKGVCQNSPGSFTCECQRGYSLDSTGMNCEDVDECGGNHR
CQHGCQNIVGGYRCSCPQGYIQHYQWNQCVDENECASQNTCGSASCFNTLGSYKCACPTG
FTFNQFSSACHDVDECTSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGIGFNRGQ
YLPVGKENSEDNALSPEGCYECQLNGYTKKTGRMRRNAKNPELERGANNTEQAMNGQISL
KSLDMDLPLKMVLNISHLNSKKHILELLPAIQPLTNHVRYVITQGNTNMFRINQRDGLSY
LHASQKILPGTYTLEITSIPLYKKTDLIELEQKKEENYLLGELGESLNIRLQIELF
Download sequence
Identical sequences F6WQA1
ENSXETP00000003713 ENSXETP00000003713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]