SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WU55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WU55
Domain Number 1 Region: 120-227
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000667
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-26
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 3 Region: 245-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000262
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WU55
Sequence length 292
Comment (tr|F6WU55|F6WU55_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000007101} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SSNCGGFLFHASGTFSSPSYPGYYPNNAECVWEIDVNSGYRINLGFNHLQMCPPPHTLYT
VIAIMDGSLNSNNLLWKICNGTRRIFTSSYNRMIVRFPSDISVRNTGYYAWYNPFARDAS
LRLVNFTSSSGACAGRVEIYHGGNWGTVCDDSWDIQDAQVVCRQLGCGDAVSALGNAYFG
SGSGPITLDDVVCSGTESTLWQCRNRVWFSHNCAHHEDAGVICSGNAVSVPALALLSDFS
GAHDSCRAFLSRPSGHFSRPSCPGNYPNNAQCVWDIEVQNNHRVTVVFRDVQ
Download sequence
Identical sequences F6WU55
ENSECAP00000007101 ENSECAP00000007101 9796.ENSECAP00000007101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]