SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WU67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WU67
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000506
Further Details:      
 
Domain Number 2 Region: 242-326,353-373
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 7.19e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 432-492
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000366
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WU67
Sequence length 504
Comment (tr|F6WU67|F6WU67_CALJA) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSCJAP00000004280} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=WAS OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSGGPMGGRPGGRGAPVVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPKKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFTGD
DCQAGLNFADEGEAQAFQALVQEKIQKRNQRQSGDRHQLPPPPTPANEERRGGLPPLPPH
PGGDQGGPPAGPLSLGLATVDIQNPDITSSRYRGLPAPVPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPVPMGIAPPPPAPRG
KPIPGRGGHPPPPPPATGRYGPLPPPPPGAGGPPMPTPPPPPPPPPSSGDGPAPPPLPPA
MVPGGGLAPGGGRGALLDQIRQGIQLNKTPGTTESSALQPPPQSSEGLVGALMNVMQKRS
RAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences F6WU67
ENSCJAP00000004280 ENSCJAP00000004280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]