SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WVA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WVA5
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000741
Family THAP domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6WVA5
Sequence length 257
Comment (tr|F6WVA5|F6WVA5_MACMU) THAP domain containing 10 {ECO:0000313|Ensembl:ENSMMUP00000019768} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=THAP10 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPASKGEEERDQAGRPDTGGELQAARH
SENVPDAVSCTRPRAGKQAAASQITCENEVVQTQPHADNPSNTVTSVPTHCEEGPVHKST
QISLKRPRHRSVGIQAKVKAFGKRLCNATTQTDELWSRASSLFDIYSSDSETDTDWDIKS
EQSDLSYIAVQVKEETC
Download sequence
Identical sequences F6WVA5
XP_001089200.1.72884 ENSMMUP00000019768 ENSMMUP00000019768 9544.ENSMMUP00000019768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]