SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WWT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WWT7
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-38
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-34
Family Second domain of FERM 0.0000711
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WWT7
Sequence length 686
Comment (tr|F6WWT7|F6WWT7_HORSE) Erythrocyte membrane protein band 4.1 like 5 {ECO:0000313|Ensembl:ENSECAP00000014755} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=EPB41L5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLSFLRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDCDLAEHG
PDLVSEFRFVPVQTEEMELAVFEKWKECRSQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKGSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKASTAKPEELSVHNSVSTQSNGSQQPWGVRSALPVNPS
IPSGPVLVEVENLPRSPGTDQRDRKCLALNIDLLDSPDLLETTIDDVIGAPDPMETSQAP
DDINIAAGQTGLEEPEVECGTLKDASEKLKHLEMENSPLLSSRPNIDVNINNQEEVVKLT
EKYLNNAIESPGLNVRRLPPDLKSNILKAQVEAVHKVTREGSLLSHKNAKGQDAATNSAV
FNESNVPLLEDSLALMHTTPAENGSVLKDATDELDALLLSLTENLIDHTVTPQVSSASMI
IPRWIVPPCSNLGRRSRLEAEVFTDD
Download sequence
Identical sequences F6WWT7
ENSECAP00000014755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]