SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WXT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6WXT8
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.27e-21
Family THAP domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6WXT8
Sequence length 176
Comment (tr|F6WXT8|F6WXT8_MACMU) THAP domain containing 3 {ECO:0000313|Ensembl:ENSMMUP00000002739} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=THAP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKEWVLNIGRGNFQPKQHTVICSEHFR
PECFSAFGNRKNLKHNAVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKCLTPRCRSQ
GLPEGGAGEDSPGRKMDTALEELQLPPNAEGPVKQAMFNVENGTPASREALWLSEE
Download sequence
Identical sequences F6WXT8
ENSMMUP00000002739 ENSMMUP00000002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]