SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6WZG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6WZG5
Domain Number - Region: 558-603
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00157
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number - Region: 233-275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00196
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6WZG5
Sequence length 840
Comment (tr|F6WZG5|F6WZG5_MONDO) CUB domain containing protein 1 {ECO:0000313|Ensembl:ENSMODP00000014123} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CDCP1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MCGRSHGGAALALLPLLVGLLPLGAVAQVGRNSGADFDIFLPRGNNITVLIKRGTLTFCN
IILQRKRLSSLTINPGERAIFSFDCPQPEKHFVLEVQKNIDCMSGSCPFGEVQLQPSRLP
ALNRTFIWNVKANPRVGLELQFSRPRLRQILPGDTCSDSVTYTISSSLEKTVVNIGTFCS
NGTVSRIKMQGGVKLELYLPWDQNRNFSGFNITNHSSIKRLCIIESVFEGEGSATLMSAN
YPKGFPEDELMSWQFVIPPHLRASVFFLNYTLSNCEKKEERVEYYIPGSHSNPEVFQLGD
QQPGNMAGNFNLSLQGCDQDSQNPGALRLLFKVLVQHLQNEGNKVYTVDLSKEKAMSMTI
EPRTFKMSRSFDRACLICEGPRKCNPNVTLTAGHKHEISFLCDDMTRLWINAEKTISCTD
IGYCTRKNYSLLVPSDIIQLPVELHDYAWKLLVPKDKISLQLTPTQKLQQHTHEKNCKTT
FSYVLSSAGQGQNLHFGSFCPGGAIEKIQVKTNISVVLRTYSPGFSNESFRQGMTVTFIH
SLKDEGVFTVTPDSKTKVYLRTPNWDRGLPPLTSVSWNISVPNHHVAHLTFSKDRMGVSC
ETGRAFMIIQEQKAKAEEIVSRDDEPLPKPKDLHHNFWVNISNCSPMNGKQLDLEFCVSL
TPKKMDMTVIILAAVGGGATLLFALGLLACYAKKMSKKKKVSKGPAVGIYNGNTNTQMPG
HVGKFQKGRKDNDSHVYAVIDDTMVYGHLLSGSNGSSTGPEVDVYRPFQGPMGDVPPSPP
PICSRVSTRKLHPEDPLPFLLPESDGEPYTFSHPKPVEVKENRDNDIPLLEKKELENIME
Download sequence
Identical sequences F6WZG5
XP_007505125.1.35504 ENSMODP00000014123 ENSMODP00000014123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]