SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6X1R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X1R6
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-26
Family C1 set domains (antibody constant domain-like) 0.00025
Further Details:      
 
Domain Number 2 Region: 341-431
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-26
Family C1 set domains (antibody constant domain-like) 0.00033
Further Details:      
 
Domain Number 3 Region: 239-324
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-26
Family C1 set domains (antibody constant domain-like) 0.00063
Further Details:      
 
Domain Number 4 Region: 452-538
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-25
Family C1 set domains (antibody constant domain-like) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6X1R6
Sequence length 539
Comment (tr|F6X1R6|F6X1R6_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000017831} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
REQEGGMVTKTTASEAAPRHSGDKFCQGASLRIWGIEKRKEAGERRQHKTKVGNSGQPKA
SPMVMAYGPSQDELRSPTATLTCLISGFYPGTLGVTWTKNGSPVSSGVLTSQPVRQTDNK
YSASSYLSVNPNQWGENNQYICKVTHEGQLCPRRNEQVILAGNILKSWTHPLDVPWEASS
TGIIWSNKMSAEVLAVEASLHSHGLLPQLSDEREGPDQCYVFGGGTKLIIEGLPKASPMV
MTYGPSQDELRTPTVTLTCLISGFYPRSLDVAWTKNGSPVSSGVLTSQPVRQTDNKYSAS
SYLSVNSNQWGREDIFICKVTHEGQCFVFGRGTRLTVTGQPKASPMVMAYGPSQDELRTP
TATLTCLISGFYPESLDVAWTKNGSPVSNGVLTSRPVRQTDNKYSASSYLSVNPNQWGEN
NQYICKVTHEGQCAVFGGGTRLTVTGQPKASPMVMAYGPSQDELRTPTATLTCLINDFYP
GSLDVAWTKNGSPVSSGVLTSRPVRQTDNKYSASSYLSVNSNQWGREDIFICKVTHEGQ
Download sequence
Identical sequences F6X1R6
ENSMODP00000017831 ENSMODP00000017831 13616.ENSMODP00000017831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]