SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6X2L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X2L0
Domain Number 1 Region: 830-1003
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-36
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6X2L0
Sequence length 1016
Comment (tr|F6X2L0|F6X2L0_XENTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSXETP00000057848} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=mapk8ip2 OC=Silurana.
Sequence
MADRAEMFSLSTFHSLSPPGCRPSQDISLEEFDDEDLSEITDDCGIGLNYDSDHCDKEGL
GFGRCDPSRALCSFQEDFQEFEMIDEEEDEEDEEDEDELPVQENIKQIEAPPSPSPSPLP
LEDSLKNRPSTLGITAPRTQDTLNNNGGFISQRESWPDPERNETDLDSQSEITQPEQDSC
QVSDSDNTVTELEMKDDSYVPPSNIQVQSTHGGLRRGDAELSVSSPSQDQTDDLSPDRRV
STRGHPSNSSNETTSPSSDPGIEADLTSHGRYLSSGHCSQDLSSPGSDSDVEGEIEAAFA
CEAGRLVGNMISSISETELDLSSESSSGRSSHLTNSIEEASSPTSDPELDHVLDGGREGL
KEAILLGKEEEIDPRVVEIEEKYSSWNIDEEAPPQEEPAKNTERSLESLRRSFYLPVGPK
LMPEPDANSEYESDSESEADLSEDSDSPWLLSNLVNKMISEGSYPITCPDECFQRQTSPS
CDTLSPASDLDPEAVEPDLETEFSASKDMSAELETTDQSIELVDMETLQNSLNHLEKEDA
GPALYVMHDSCDTVTPIYEGLSHHLEQLSHTAKCRTQSPVHRSEQKLWNGRQETMQEPAD
GWDIDRDLDSGILVDNDLCDDLCQELDQSQPSLDISTAKTNRGFNLDYTGEKDDEISYYR
SLKNSPFENCVVEENFLEPPLTETRLMDDSLAYDSVKYTLVVDEHTQLELVSLQRCTSIL
SDGSDLLTTCNPCDLEEDDFGDEVDAQEQESSSGDSSPEPNMPFSKKFLNVFVNSTSRSS
STDSFGLFSCVINGEEREQTHRAVFRFIPRHEDELELDVDDPLLVECEDGSWCRGYNMRT
GERGIFPSFYAHEVVCPVKENVVLRGNSPWVQMFDAQFLGSVEVPNHQGNGILCAAMQKI
ATARKLTVHLRPPASCELEISLRGVKLILRGNDRPEDERCSHFFQMKNISFCGCHPRNSC
YFGFITKHPVLNRFACHVFVSQDSMRRVAECLGRAFQEFYQENVEFSCPTEDIYLE
Download sequence
Identical sequences F6X2L0
ENSXETP00000057848 ENSXETP00000034216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]