SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6X2Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X2Y2
Domain Number 1 Region: 38-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.02e-17
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 161-222
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.38e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 3 Region: 219-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.19e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 125-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000139
Family LIM domain 0.00087
Further Details:      
 
Domain Number 5 Region: 1-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000257
Family LIM domain 0.0028
Further Details:      
 
Domain Number 6 Region: 96-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000357
Family LIM domain 0.0015
Further Details:      
 
Weak hits

Sequence:  F6X2Y2
Domain Number - Region: 278-307
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00963
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6X2Y2
Sequence length 336
Comment (tr|F6X2Y2|F6X2Y2_MACMU) LIM and senescent cell antigen-like-containing domain protein {ECO:0000256|PIRNR:PIRNR038003} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=LIMS2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSDALANAVCQRCQARFAPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCE
HDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNASRHLCRP
CHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELKGELY
CLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYC
ETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFDMKPVC
KRCYEKFPLELKKRLKKLSELTSRKAQPKAADLNSA
Download sequence
Identical sequences F6X2Y2
XP_014965296.1.72884 XP_014965297.1.72884 ENSMMUP00000036004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]