SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6X335 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X335
Domain Number 1 Region: 130-246
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000156
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000214
Further Details:      
 
Weak hits

Sequence:  F6X335
Domain Number - Region: 262-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00458
Family Retrovirus zinc finger-like domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6X335
Sequence length 602
Comment (tr|F6X335|F6X335_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000001953} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MATGANARPLDFPSQKRQRSCWNKSMEQKTVIAGIPTVIPPDLLENNNKLQLPLEDLTRK
LRMGDLGIPNPKDRSPSPEPFTVTRGKRLNAPEFRTRKKLEEERHNPLTQMVALNTDFKP
PADCKPPVTRVSDKVMIPQVEYSEINFVGLLIPRGNTPKNLEKECNAKIMIRGKGSVKEG
KFGCKDGQRLPEEDEPLKAVTANKMENIKKAVEQIRNVLKQGIETPEYQNHLRKLQVWEF
AGLNGTFRDNRILRPWQSSETCSITNTTVCTKCGGADHIASDCKFQRPRDHQPAQEKARM
NKEYLFLMAELGEAPVPASVDSVSGPATTALASSPRPAAPASNPPPPSLMSTTQSCPPWM
NSGTSESRPYHGMHGGVAGGPGGGPQSFPHPLPSLTGRHGGYPMQHNPYRLPPTWMQPPP
PMNQGPHRPGHHGPPPMDQYLGSTPVGSGVYHLHQGKGMMALPPPSGPLPPSPPPPPPSS
NMASSTPLPWQQNTMTATTSAGTGFIHPKQQQVAATAFPGVPQIQGNPTIVPLPPGVQST
LLPGPPPLPRLLPGSSGMMFALPAPPASPMDPSNFVTMMGMVVAGMPPFGMPPVPPTPPP
QN
Download sequence
Identical sequences F6X335
ENSCJAP00000001953 ENSCJAP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]