SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6X3J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X3J2
Domain Number 1 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 374-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-20
Family KRAB domain (Kruppel-associated box) 0.00048
Further Details:      
 
Domain Number 8 Region: 177-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 136-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 76-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000184
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 276-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000165
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6X3J2
Sequence length 637
Comment (tr|F6X3J2|F6X3J2_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000019599} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SVAIEDVTVSFTLEEWALLDPSQKKLYRDVMWETFRNLASVGKTWEDHDIEEKYQKQERK
LRSHMVERLCESEEGGQCGENFSLLPNLKLKKKPTAAKPYKCSACGKVFMHHSSLNRHVR
CHNEHRPHAYQKCAEKPYKCKECGKAFPFPSSLQIHERTHTGEKPYECKNCGKAFISSNL
RSHMISHTGDGPYKCKECRKVFISPSAFRIHERSHTGEKPYECKNCGKAFTSSNAFQIHE
RSHTGEKPYECKYCGKAFISSRSLRIHERRHTGEKPYECKNCGKAFSDPSSFRMHGRLHA
GKRPYKCKECGKAFIALTNLRVHMITHTGVGPYKCKECGKVFIHPSSFQIHERSHTGEKP
YECKECGKAFTLTSYSSFRRHERNHTREKPYECKKCSKTFAYPSSLRVHEITHTGEKPYE
CKECGKAFRDPSSLRSHMISHTGDRPYKCKECEKAFISPSAFRVHKRSHTGEKPYECKEC
GKAFSCSSSLRVHERIHIGEKPYECKECCKSFSRTSSLRVHERVHTGEKPYECKECSKAF
TSSSSLRGHERVHTGEKPYECEKCNKAFISSSSLRGHERVHTGEKPYECKECRKAFSSHQ
NFQIHKRNHTGEKLYECEKCHKAFSFPSSLRRHERTH
Download sequence
Identical sequences F6X3J2
ENSECAP00000019599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]