SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6X3L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6X3L0
Domain Number 1 Region: 356-606
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.02e-50
Family Creatinase/aminopeptidase 0.0001
Further Details:      
 
Domain Number 2 Region: 89-166
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.00000000994
Family Creatinase/prolidase N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6X3L0
Sequence length 671
Comment (tr|F6X3L0|F6X3L0_HORSE) X-prolyl aminopeptidase 2 {ECO:0000313|Ensembl:ENSECAP00000019596} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=XPNPEP2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MAWARWGCCPWLVLLCACTWGRPKAANLTREDVRNCSTSPPYIPVTAVNTTERLTALRQQ
IQMLNLSAYIIPDTDAHMSEYIGDHDKRRAWITGFTGSAGTAVVTMGKAALWTDSRYWTQ
AERQMDCNWELHREGNIVTWLLTEVPVGGLVGFDPFLFSIDSWESYNADLQASDRQLVSI
ADNLVDLVWGSERPAVPSQPIYALQEAFIGSTWQDKVSDIRSQMQQRREAPTAVLLSALD
ETAWLFNLRSSDIPYNPFFYSYTLFTDSFIRLFVNKSRLSSETLQYLNADCTLHMCVQLE
DYSQVRDSIKAYASGDVRIWIGTSYTTYGIYELIPKEKLVEDTYSPVMVTKAVKNSKEQA
LLRASHVRDAVAVIRYLVWLEKNVPSGAVDEFSGAELLDKFRGEEEFSSGPSFETISASG
LNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVL
IGNIDLSRLVFPAATSGRMVEAFARKALWDVGLNYYHGTGHGIGNFLCVHEWPVGFQSSN
IAMAKGMFTSIEPGYYQDGEFGVRIEDIALVVEAETKYPGTYLAFEVVSLVPYDRNLIDV
SLLSPEQLQYVNRYYQTIREKVGPELQRRQLLEEFAWLQQHTEPLSARAPRAASLVSLLA
VSVLAILGWSA
Download sequence
Identical sequences F6X3L0
ENSECAP00000019596 9796.ENSECAP00000019596 ENSECAP00000019596 XP_005614548.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]