SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XA24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XA24
Domain Number 1 Region: 843-1078
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-56
Family DBL homology domain (DH-domain) 0.0000359
Further Details:      
 
Domain Number 2 Region: 1075-1204
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-34
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 663-714
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000159
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0097
Further Details:      
 
Weak hits

Sequence:  F6XA24
Domain Number - Region: 135-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00042
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6XA24
Sequence length 1706
Comment (tr|F6XA24|F6XA24_CANLF) Rho guanine nucleotide exchange factor 28 {ECO:0000313|Ensembl:ENSCAFP00000012162} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGEF28 OC=Canis.
Sequence
MELSCSEVPLYGQMTVYAKFGKNVYLPKDAEFYFIYNGSHQRHVVIAKRTEDNVLQSSIP
GHGLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQADRLTASSHQTFLT
PFALTVGALPALDEELVLALTHLELPLEWSVLGNSSLEVSLCRESLLHLAMRWGLPKLSH
FLLCLPGGVQALSLPNEEGATPLDLALRAGHSKLVEDITNFQGRRSPDLSRVHLGGRAFL
QYVHPSGTLTLTLNHTAEHLLEADIKLFRKYFLDRAFLLKALDDREAGPEESRGMPSRAA
ATEEGTRAASPAPRNPEEIRNLVTGRPSPEKEDVKRVDSPDVDPHEHDGRDSLDLDHSFD
VFKKPKHPPAFFAAGGLSDVLNGGDEVYANCMVIDQVGDLDINYINLEGISTDACAESMG
STLGPQNCEHILAAETSHGKYPLSENKEVVSDTEAQQSFPSPSSSYASNFDLSFGLHGFE
KEQSLLKKRSSSLDALDADSEGEGHSERSHICYTPASQSSSRTGIPSGDELDSFETATKP
DFSISRTESLSLSSSLQLKESLLPGVRSRSYSCSSPKISLGKTRLVRDFTVCNSGEEQRA
FGFPEPARERRIQEEEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKD
KEKPSRHQFVPGTFSGVLQCSVCDKTLLGKESSQCSNCNANVHKGCKDAAPPCTKKFQEK
YNKNKPQTILGNSSFRDIPQPSLSLHPSSSMPIGLPTGRKEASAQAHPLSRSVPGTALES
FRRSGLSLESESDGNSWRSRSHSDELLQSMGSSPSTESFLMEDVVDSSLWSDLSSDAQEL
EAESWSLVVDPSFCNKQEKDVIKRQDVIFELMQTEMHHIQTLLIMSEIFRKGMKEELQLD
HSTVDKIFPCLDELLEIHRHFFYSMKERRQESCAGGDRNFVISRIGDILVQQFSEENANQ
MKKIYGEFCSHHKEAVSLYKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKY
PVLVERILQYTKERSEEHQDLCKALCLIKDMIAAVDLKVSEYEKNQKWLEILNKIENKTY
TKLKNGHVFRKQALISKERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIF
AAVDQKPSVISLQKLIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQA
VESCPEEEGGRTSESDEERRKAEARVAKIQQCQEILSNQDQQICAYLEEKLHIYAELGEL
SGFKDVHLEPHLLIKPDPGEPPQAASLLAAALREAESLQVAVKASQAGDARPSPEEGSAE
PAVADAQGPPEEPGSSPASLVTEGTGGRGCWDVDPGPQGVGTDLAVSDAGEKVEYRSFTV
SSQSEIIQAIQNLTRLLYSLQAALTIQDSHIQVHRLLLQQAGLPASQEEHGELARQREEL
AALPGLQWQLQQERRRGQRTWERQQREQEARACRLREREQGCRGREELLLRARGELDRQL
REHRQDLERLREGQRLVESARARTRAQHSLLRGPRPGRQSSLPAALPPGSGEVMELNRSE
SLCHENSFFINEALVQMSLNTYNKSTPSGVHQEAAYPQNIANSDLVRTSESPVDLQLDIS
QPLDVNHELWTAAGSCHQIPPLHESSKDSCKNGLRTPHPGPSASPEPSARSSRLQTGAAE
AAHNLQTRTGQDAETGDAAEENIVYL
Download sequence
Identical sequences F6XA24
ENSCAFP00000012162 ENSCAFP00000012159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]