SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XDP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XDP3
Domain Number 1 Region: 338-467
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-26
Family Ran-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6XDP3
Sequence length 469
Comment (tr|F6XDP3|F6XDP3_HORSE) Nucleoporin 50 {ECO:0000313|Ensembl:ENSECAP00000014056} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NUP50 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLFVPSGGGGFSGFGSGAGGKPLEGLSNGNSVTGAPPFSSARAAAETKAAFGSIAANG
PTSLVDKKISNPKTNGDSQQPSSSGLTSSAAPVGNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLASIEQQHGNSGSSNSESEANKMSVETQSPSLFGSTKLQQESPFLF
HGNKTEDTSAKKLEAVSEKKTDPSLGATSASFNFGKKVDSSILGSLNSGPLTGFSFSSGN
SSLFGKDSTQNKPVPSPFSAKTLESPAEGGSNECKGGDEEENDEPPKVVVTEVKEEDAFY
SKKCKLFYKKDNEFKEKGVGTLHLKPTANQKTQLLVRADTNLGNILLNVLVPPNMPCART
GKNNVLIVCVPNPPVDEKNATIPVTMLIRVKTSEDADELHNILLEKKDV
Download sequence
Identical sequences F6XDP3
NP_001296247.1.31192 XP_005606830.1.31192 ENSECAP00000014056 ENSECAP00000014056 9796.ENSECAP00000014056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]