SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XDR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XDR3
Domain Number 1 Region: 45-89
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000541
Family Ovomucoid domain III-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6XDR3
Sequence length 90
Comment (tr|F6XDR3|F6XDR3_MOUSE) Predicted gene 10542 {ECO:0000313|Ensembl:ENSMUSP00000095193} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gm10542 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
RFDKISPIWVRSLFILNVVFPPYFVAETAVAHLRRLFKVPNCEPYRSVTICLDTLNPVCG
DDGKSYDNHCYFCTETFRKNLSYKHHGVCT
Download sequence
Identical sequences F6XDR3
ENSMUSP00000095193 10090.ENSMUSP00000095193 ENSMUSP00000095193 ENSMUSP00000095193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]