SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XED8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XED8
Domain Number 1 Region: 6-483
Classification Level Classification E-value
Superfamily Sema domain 6.8e-184
Family Sema domain 0.0000000000366
Further Details:      
 
Domain Number 2 Region: 479-530
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  F6XED8
Domain Number - Region: 547-591
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0391
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6XED8
Sequence length 600
Comment (tr|F6XED8|F6XED8_XENTR) Semaphorin 3F {ECO:0000313|Ensembl:ENSXETP00000015932} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sema3f OC=Silurana.
Sequence
DLKASGTAHFLSFLLNTTDYRILLKDEDHDRMYVGSKDFILSLDLQDINREPLIIHWPAS
QQRIEECVLSGKDSNGECGNFIRLIQPWNRTHLYVCGTGAYNPVCTYINRGRKAQDYVFY
LEPDRVESGKGKCAYDPKLDSVSALINEELYSGVYIDFMGTDAAIFRAMGKQAAMRTDQY
NSRWLNDPAFVHVHLIPDSADRNDDKLYFFFREKSTDSPHSPTVYSRIGRVCLNDDGGHC
CLVNKWSTFLKARLICSVPGADGIETHFDELQDVFIQQTQDNKNPVIYAVFSSSGSVFKG
SAVCVYSMSDIRMVFNGPFAHKEGPNYQWMPYTGKIPYPRPGTCPGGTFTPSMKSTKDYP
DEVINFMRTHPVMYNPVYPVHRQPLLVRTNVNYRFTTIAVDQVDASDGRYEVLFLGTDKG
TVQKVIVLPKDDLETEELILEEVEVFKVPAPIKSMKISTKRQQLYVASMSGVTHVALHRC
DVYGEACADCCLARDPYCAWDGKTCSRYSASSKRRSRRQDVRHGNPMRQCRGYNSNASKN
GVDGVQYGVEGSSAFLECQPRSPQAAVKWILQKDNTDRKKELRSEGRFLKTEQGLLMRSL
Download sequence
Identical sequences F6XED8
ENSXETP00000015932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]