SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XG52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XG52
Domain Number 1 Region: 117-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.004
Further Details:      
 
Domain Number 2 Region: 248-342
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000126
Family Cadherin 0.0038
Further Details:      
 
Domain Number 3 Region: 58-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000514
Family Cadherin 0.02
Further Details:      
 
Weak hits

Sequence:  F6XG52
Domain Number - Region: 351-449
Classification Level Classification E-value
Superfamily Cadherin-like 0.00014
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6XG52
Sequence length 652
Comment (tr|F6XG52|F6XG52_MACMU) Cadherin related family member 5 {ECO:0000313|Ensembl:ENSMMUP00000005371} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=CDHR5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGSWALLWPPLLLTGLLGRPPGTVAQVQYCSVNKSFFEVEENTNVTEPLVDIHVPEGQEV
TLGPLSTPFAFRIQGNQLFLNVSPDYEENSLLEAQLLCQSGGTPVTQLRVFVSVLDVNDN
APEFPFTTKEIRVEEDTKVNSTVIPETELQAKDKDKDDILFYTLQEATAGASDYFSLVGV
NHPALRLDRPLDFYERPNMAFRLLVRDTPEENVEPSHTATATLVLNVVPADLRPPWFLPC
TFSDGYVCIQAQYHGAVPTGHTLPSPLVLHPGPIYAEDGDRGINQAIIYSIFSGNVNGTF
VIHRDSGNLTMARSVPRAMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYR
GTVALGAGAGVVVKDAAAPSQPLRVQARDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT
TLTQAGAFYAEVEAKNTVTSGTATTVIEIQVSEQEPPSTGGGPSEDKRFSVVDMAALGGV
LGALLLLALLGLTVLVHKHYGSRLKCCSGKAPEPQPSGYDNQAFLPDDEANWAPAPSPTS
DAKPAEAPPTPAEPAPPGPAPPGSAPEAPAAAVAGGSPAAVRSILTKERRPEGGYKAVWF
GEDIGAEADVVVLNTPTLDVDGASDSGSGDEGEGAGPGRGSHDEPGGDDSYI
Download sequence
Identical sequences F6XG52
ENSMMUP00000005371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]