SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XK52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XK52
Domain Number 1 Region: 1565-1682,1762-1870,1913-1974,2131-2161
Classification Level Classification E-value
Superfamily Sialidases 0.00000000124
Family Sialidases (neuraminidases) 0.02
Further Details:      
 
Domain Number 2 Region: 472-525,669-744,827-856,898-926,1039-1061
Classification Level Classification E-value
Superfamily Sialidases 0.000000163
Family Sialidases (neuraminidases) 0.034
Further Details:      
 
Domain Number 3 Region: 2414-2502,2600-2625,2659-2711
Classification Level Classification E-value
Superfamily Sialidases 0.00000765
Family Sialidases (neuraminidases) 0.047
Further Details:      
 
Weak hits

Sequence:  F6XK52
Domain Number - Region: 2369-2394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000512
Family Integrin beta EGF-like domains 0.026
Further Details:      
 
Domain Number - Region: 2465-2550,2658-2692,2743-2988
Classification Level Classification E-value
Superfamily Sialidases 0.000902
Family Sialidases (neuraminidases) 0.026
Further Details:      
 
Domain Number - Region: 563-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 921-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 1411-1452,1568-1621
Classification Level Classification E-value
Superfamily Sialidases 0.0054
Family Sialidases (neuraminidases) 0.045
Further Details:      
 
Domain Number - Region: 2017-2048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00577
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 1033-1087,1206-1268
Classification Level Classification E-value
Superfamily Sialidases 0.0101
Family Sialidases (neuraminidases) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6XK52
Sequence length 3347
Comment (tr|F6XK52|F6XK52_HORSE) Reelin {ECO:0000313|Ensembl:ENSECAP00000019013} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=RELN OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQIIFKDALA
QQLCEQGAPTEATLHPHLAEIHSDSIILRDDFDSYHQLELNPNIWVECNNCETGEQCGAI
MHGNAVTFCEPYGPRELITTSLNTTTASVLQFSIGSGSCRFSYSDPSITVSYAKNNSADW
TLLEKIRAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYEACWALDNILVINSA
HRQVILEDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSSE
DIQEQWSEEFESQPTGWDILGAVIGTECGTIESGLSMVFLRDGERKLCTPYMDTTGYGNL
RFYFVMGGICDSGDSHENDIILYAKIEGRKEHIALDTLSYSSYKVPSLVSVVINPELQTP
ATKFCLRQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFS
TNHGRSWSLIHTECLPEICAGPHLPHSTIYSSENYSGWNRITIPLPNAALTRDTRIRWRQ
TGPILGNMWAIDNVYIGPSCLKFCSGRGQCTQHGCKCDPGFSGPACEMASQTFPMFISES
FGSSRLSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTL
RLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLNYHEPRIISVELPDDARQ
FGIQFRWWQPYHSSQGEDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPCC
GHDWTLCFTGDSKLASSMRYVETQSMQTGASYMIQFSLVMGCGKKYTPHMDNQVKLEYST
NHGLTWHLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVTVLLPQKTWSSATRFRWSQS
YYTAQDEWALDNIYIGQQCPNMCGGHGSCDRGLCRCDQGYQGTDCQPEAALPSTIMSDFE
NQNGWESDWQEVIGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSWDLDTSWADFVQFYI
QIGGESAACNRPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPC
TRFRWWQPVFSGEDYDQWAIDDIIILSEKQKQIIPAVNPTLPQNFYEKPAFDYPMNQMSV
WLMLANEGMVKNETFCSATPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCATQFS
SAAPVLLQYSHDAGMSWFLVREGCYPASAGKGCEGNARELSEPTVYHTGDFEEWTRITIV
IPRSLASSKTRFRWIQESSSQKSLPPFGLDGVYISEPCPSYCSGHGDCVSGVCFCDLGYT
AAQGTCVSNVPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGRSLYFNGPGKREAR
TVPLDTRNIRLVQFYIQIGSKTSGIACIKPRARNEGLVVQYSNDNGIIWHLLRELDFMSF
LEPQIISIDLPREAKTPATAFRWWQPQHGHSAQWALDDVLIGMNDSSQTGFQDKFDGSID
LQANWYRIQGGQVDIDCLSMDTALVFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSKP
FSSSHSVQLQYSLNNGKDWHLVTEECVPPTIGCLHYTASSIYTSERFQNWKRITVYLPLS
TMSPRTRFRWIQANYTVGADSWAIDNVVLASGCPWMCSGRGICDAGRCVCDRGFGGAFCV
PVVPLPSILKDDFNGNLHPDIWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLD
CANTLYVQFSLRFIAKGTPERSHSILLQFSINGGITWHLMDEFYFPQTTSILFINVPLPS
TAQTNATRFRLWQPYNNGKKEEIWIVDDFIIDGNNLNNPVMLLDTFDFGPREDNWFFYPG
GNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFEINVGCSTDSSS
ADPVRLEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTTQGWRREVVHFG
RLHLCGSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGHGSCINGTKCICDPGYS
GPTCKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLMT
RDLDLSHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRY
IALEIPLKARAASTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFTTLDSRKW
LLHPGGTKMPVCGSTGDALVFIEKASTRYVVTTDVAVNEDSFLQIDFAASCSVTDSCYGI
WEDFTKELSLKWELVVGEFVLDRVMNKRAQVQRVTLKEGQNKYITPTKCQAPYAESQATR
FRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCIHGNCVCDEQWGGLYCDEPEASLP
PQLKDNFNRAPSSQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAEFI
QFYFMYGCLITPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEIA
TRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRI
AFDMFMEDKTAVNEHWLFHDDCTVERFCDSPDGVMICGSHDGREVYAVTHDLTPAEDWIM
QFKISVGCKVSEKVAQNQIHVQYSTDFGVSWNYLVPQCLPADPKCSGTVSQPSVFFPTKG
WKRITYPLPESLVGNPVRFRFYQKYSDVQWAIDNFYLGPGCLDNCRGHGDCLKEQCICDP
GYSGPNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDTALYFGGSTVR
QAITQDLDLRGAKFLQYWGRIGSENNMTSCHRPVCRKEGVLLDYSADGGTRITWTLLHEM
DYQKYISVRHDYILLPEDALTNTTRLRWWQPFVISNGLVVSGVERAQWALDNILIGGAEI
NPSQLVDTFDDEGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTDNALSSRELI
IQPGYMMQFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQ
FHEATIYNAVNSSSWKRVTIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPK
LCSGHGSCTTGAVCICDESFRGDDCSVFSHDLPSYIKDNFESARVTEANWETIQGGVIGS
GCGQLAPYAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSTAQTDSCNSDLSGPH
AVDKAVLLQYSINNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGT
GHDQWALDHVEVVLVITRKQNYMMNFSRQHGLRQFYNRRRRSLRRYP
Download sequence
Identical sequences F6XK52
ENSECAP00000019013 ENSECAP00000019013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]