SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XKF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XKF7
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 2 Region: 52-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6XKF7
Sequence length 282
Comment (tr|F6XKF7|F6XKF7_CALJA) CD320 molecule {ECO:0000313|Ensembl:ENSCJAP00000019719} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CD320 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
TSGWMARGGVERTGALGLALRLLLGLGLSLEAAATPLPTQTSGQAAGDRAGSCPPTKFQC
RTGDLCVPLNWRCDTDEDCPDASDEEECPIEPCTQNGQCPPPPGHLCSCTGVSDCSGETD
EKLRNCSRPTCPAGELHCTLSDECIPLTWLCDGHPDCSDSSDELGCGTSETLLKGNATTM
GPPVTFESVTSLRNATSSGRPIAAAELPSPCGQSLVGLGALAFPSYYSSVHLFPTAVLST
SLVAATLLLLFWLRAQGRLCPMGLLVNAKESLVVSERKTFLI
Download sequence
Identical sequences F6XKF7
ENSCJAP00000019712 ENSCJAP00000019719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]