SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XKH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XKH1
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 343-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.68e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 100-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000824
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6XKH1
Sequence length 407
Comment (tr|F6XKH1|F6XKH1_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000005545} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNKGPVTLKDVIVEFTKEEWKLLTPAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKLKQ
GREPWILEVEYPHRGFPEDLWSIHDLEARYRESQAGNSRNGELTKHQKTRTTEKAYECKE
CGKFFCQKSALIVHQHTHSKGKSYDCDKCGNSFSKNEDLTRHQKIHTRDKTYECKECKKI
FYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLIEHQKTHTGEKPFECTECGKFFYVK
AYLMVHQKTHTGEKPYECKECGKAFSQKNVGNASTRSQPSQYISELTQGEKPFECNKCGK
TFYYKSDLTKHQRKHTGEKPYECTECGKSFSVNSVLRLHQRTHTGEKPYSCKECGKSFSQ
KSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAHQKTHTKKRKAEK
Download sequence
Identical sequences F6XKH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]