SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XLB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XLB8
Domain Number 1 Region: 84-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-97
Family Protein kinases, catalytic subunit 0.00000973
Further Details:      
 
Domain Number 2 Region: 712-821
Classification Level Classification E-value
Superfamily KA1-like 1.96e-47
Family Kinase associated domain 1, KA1 0.00000569
Further Details:      
 
Weak hits

Sequence:  F6XLB8
Domain Number - Region: 349-397
Classification Level Classification E-value
Superfamily UBA-like 0.003
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6XLB8
Sequence length 821
Comment (tr|F6XLB8|F6XLB8_MONDO) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00804148} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=MARK1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSARTPLPTVNERDTENSLKWCGNKNTKFLTSNDCLVGETAYYMHTSVDGYPEPHIQPTK
SSSRQNIPRCRNSITSSTDEQPHIGNYRLLKTIGKGNFAKVKLARHVLTGREVAVKIIDK
TQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGR
MKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADMNIKIADFGFSNEFTIGNKL
DTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGK
YRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPEPDFNDT
KRIDIMVTMGFSRDEINVSLINQKYDEVMATYLLLGRKPPEFEGSESLSSGNLCQRSRPS
SDLNNSSMQSPAHLKVQRSISANQKQRRFSDHVGPTIPAAVSYTKRAQANSAESEQKEEW
DKDVSHKLGSTIVGSKAEMTASPLVGPERKKSSTMPSNNAFSGTGMTRRNTYVCERTTDR
YSAIQNGKDSSLTEMSATSTSSAGSAITSAAPSTRPRHQKSMSASGHPIKVTLPTIKDGT
DYRPGTTQRVPAASPSAHSISATTPDRTRFPRGSSSRSTFHGEQLRERRNATYNGPPASP
SHETGTFSHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKEREKEDSKD
SKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKEKFLLFCVHGDARQDSLVQ
WEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences F6XLB8
ENSMODP00000005696 ENSMODP00000005696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]