SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XLM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XLM8
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.75e-18
Family Ubiquitin-related 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6XLM8
Sequence length 137
Comment (tr|F6XLM8|F6XLM8_MONDO) 40S ribosomal protein S30 {ECO:0000256|RuleBase:RU364011} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FAU OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
AVATMQLFVRAQALHTLQVTGQETVAQIKAHVASLEGIAPEDQVLLLGGSPLEDEAILGQ
CGVEPLATLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRF
VNVVPTFGKKKGPNANS
Download sequence
Identical sequences F6XLM8
13616.ENSMODP00000012644 ENSMODP00000012644 ENSMODP00000012644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]