SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6XNL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6XNL1
Domain Number 1 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 4 Region: 377-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-21
Family KRAB domain (Kruppel-associated box) 0.00044
Further Details:      
 
Domain Number 6 Region: 179-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.5e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 232-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 137-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 10 Region: 332-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000501
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 533-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000501
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 82-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000266
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6XNL1
Sequence length 649
Comment (tr|F6XNL1|F6XNL1_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000014409} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
DSVTFEDVSVKFTMEEWALLGPSQKKLYRDVMKETFRNLASIGGKWEDHNVEDHYENHRT
DLSSHMLERLVKSKERSQYGETFSQIPIHNQTKKTPVGIKLCKCSFCGEVFMDHSSFSRH
LRSHATSKSCVYQECEEKPYKCRECGKAFKYRQSIRKHERIHTGEKPYRCKHCGKALSCF
SYCRLHEKSHTGEKPYECKQCGKAFSCPTYFRKHERIHTGEKPYKCKQCGKAFSCHRSFR
SHERGHSGEKPYECMKCGKAFSCPNYFQKHKRIHTGEKPPYECKQCGKTFAYLSSIQKHE
RTHSGEKPYECKECGKAFIYLSNVQRHMIKHTGDGPYKCKECGKAFDCPSSLRTHERTHT
GEKPYQCKSCSKAFTRWSISLQIHERTHTGERPYECRNCGQAFTFSKSLRIHERIHMGEK
PYDCKECGKAFSAPSSLRSHMISHTGDGPYKWKECKKVFVSHSAFQIHERSHTGEKPYEC
KNCGKAFISSRSLRIHERRHTGEKPYECKNCGKAFIYSRSLQIHERRHTGEKPYECKNCG
KAFSHPNTFRMHERRHTGKRPYECKECGKAFIAAFSCSSSLRKHERIHTGEKAYECKECS
KSFTRSTSLQVHERTHTGEKPYECKECSKAFISSSSLREHERVHMRKKL
Download sequence
Identical sequences F6XNL1
9796.ENSECAP00000014409 ENSECAP00000014409 ENSECAP00000014409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]